SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018926 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018926
Domain Number 1 Region: 25-98
Classification Level Classification E-value
Superfamily Virus ectodomain 2.78e-27
Family Virus ectodomain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018926   Gene: ENSFCAG00000026324   Transcript: ENSFCAT00000024296
Sequence length 126
Comment pep:novel chromosome:Felis_catus_6.2:D3:16442487:16625431:-1 gene:ENSFCAG00000026324 transcript:ENSFCAT00000024296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALLGLGLAEVGTGISSLVIQDKNYRTLRAAIDLDIERIEKSISHLQKSLTSLSEVVLQ
NRRGLDLLFMQQGGLCAARGEECYFYVDHLGVVKESMALTREGLQKRKLEREQSQSWYES
LFNWSP
Download sequence
Identical sequences ENSFCAP00000018926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]