SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018990 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018990
Domain Number 1 Region: 351-632
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.11e-78
Family Protein kinases, catalytic subunit 0.0000000428
Further Details:      
 
Domain Number 2 Region: 802-944
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.44e-57
Family FAT domain of focal adhesion kinase 0.00000741
Further Details:      
 
Domain Number 3 Region: 71-189
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-42
Family Second domain of FERM 0.000021
Further Details:      
 
Domain Number 4 Region: 194-299
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-30
Family Third domain of FERM 0.00015
Further Details:      
 
Domain Number 5 Region: 2-70
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.03e-22
Family First domain of FERM 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018990   Gene: ENSFCAG00000014420   Transcript: ENSFCAT00000031445
Sequence length 947
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:49840470:49872729:1 gene:ENSFCAG00000014420 transcript:ENSFCAT00000031445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVIASILLSGRIGPNIQLGECYGLRLKHMKSDEIHWLHPQMTVGEVQEKYECLHMEAEW
RYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFF
KDMPHNALDKKSNFEFLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECV
MKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLAEFKQIKS
IRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKGSLIIHPK
KDGEKRNSLPQIPVLNLEAQRPHLSESCSIESDIYAEIPDETLRRPGGPQYGVTRDDVVL
NRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFLSEAVIMKNLDHPHIV
KLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVH
RDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKAKASVTRLPIKWMSPESINFRRFTTA
SDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYD
PSERPRFTELVCNLSDIYQMEKDIAIEQERNARYRPPKILEPTAYQEPPPKPSRPKYRPP
PQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFI
RPSSREEAQQLWEAERLKMRQILEKQQKQMVEDYQWLRQEEKSLLCRTPMVYMNDKSPLT
PEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNELCQLP
PEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQ
NAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences ENSFCAP00000018990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]