SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019167 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019167
Domain Number 1 Region: 706-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000279
Family Laminin-type module 0.0000641
Further Details:      
 
Domain Number 2 Region: 602-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000017
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 164-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 4 Region: 762-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 5 Region: 813-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 6 Region: 325-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 276-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 651-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 9 Region: 220-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 10 Region: 861-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000019167
Domain Number - Region: 1155-1404
Classification Level Classification E-value
Superfamily Tropomyosin 0.000157
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 959-1170
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000201
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019167   Gene: ENSFCAG00000024895   Transcript: ENSFCAT00000026548
Sequence length 1487
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:24700666:24829461:-1 gene:ENSFCAG00000024895 transcript:ENSFCAT00000026548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFNK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCQGNTDGAKCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGYHSLTEAGCRPCSCNPSGSIDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFQIDEDGWHVEQRDGSEASLEWSS
ERQDVAVISDSYFPRYFIAPAKFLGKQLLSYGQNLTFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPPLTPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLTSARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCNCRDNTAGPHCEKCGDGYYGDSTAGTSSDCQPCPCPGGSSCA
VVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKDGFFGNALAPNPADKCKACDCHPYGTVKQQRGCNPVT
GQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRSGQCECQPGITG
QHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSRPGCQECPACYRLVKDKVADHRMKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREV
MDLLREAQDVKDIDQNLIDRLQRLNNTLSSQISRLQNIRNTIEETGNLAEQARARVESTE
QLIEIASRELEKAKIAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSTEAYDLLLRTLAGENQTTLEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDHLIDQKLKDYEDLREDMRGKELEVK
KLLEKGKIEQQTADQLLARADAAKAVAEEAAKKGRNTLQEANDILSNLRDFDRRVNDNKT
AAEEALRRIPAINQTIIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQRNATS
TKAEAEKTFAEVTDLDNEVNDMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEIN
ARKAKNSVTSLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLE
NEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences ENSFCAP00000019167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]