SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000019270 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000019270
Domain Number 1 Region: 29-124
Classification Level Classification E-value
Superfamily Snake toxin-like 5.15e-25
Family Extracellular domain of cell surface receptors 0.024
Further Details:      
 
Domain Number 2 Region: 138-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000756
Family Extracellular domain of cell surface receptors 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000019270   Gene: ENSFCAG00000025558   Transcript: ENSFCAT00000022021
Sequence length 343
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:12240471:12244614:1 gene:ENSFCAG00000025558 transcript:ENSFCAT00000022021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPARKAGAQAVIWTTGWLLLLSLLLGEGARALECYSCVQKADDGCSPQKTKTVKCAPGV
DVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLHGLLAFMQLQQCAQDRCNAKLN
LTSRALNPAGNESAYPSNGAECYSCVGLSHEACRGTAPPVVSCYNASERVYKGCFDGNVT
LTAANVTVSLPVRGCVQDEFCTRDAVTGPGFTLSGSCCQGSRCNSDLHNKTFFSPRIPPL
VLLPPPKPTTQAPTTSVTTSTPAPTTLVSATKPTTASQTSPREVHPETSQKEESGLAGGA
AGHQDRRNMGQHPTGGGAHNKGSSTSSAGLAALVLALAAGTLP
Download sequence
Identical sequences M3WY30
ENSFCAP00000019270 XP_006941253.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]