SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020058 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020058
Domain Number 1 Region: 338-630
Classification Level Classification E-value
Superfamily Kelch motif 1.11e-76
Family Kelch motif 0.0000155
Further Details:      
 
Domain Number 2 Region: 66-186
Classification Level Classification E-value
Superfamily POZ domain 8.63e-32
Family BTB/POZ domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000020058
Domain Number - Region: 267-346
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0994
Family B3/B4 domain of PheRS, PheT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020058   Gene: ENSFCAG00000027267   Transcript: ENSFCAT00000030468
Sequence length 652
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:95420800:95463273:-1 gene:ENSFCAG00000027267 transcript:ENSFCAT00000030468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPQRYNTKSNYSGTKNTKTLREYSVEPAFRSLVEDEDQHMKLSLGSSEMGLSSHLQCSKS
GTTRIFTSNTHSSVVLQGFDQLRLEGLLCDVTLMPGDTDDAFPVHRVMMASASDYFKAMF
TGGMKEQDLMCIKLHGVSKVGLRKIIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFC
KVFLISGVTLDNCVEVGRIANTYNLTEVDKYVNSFVLKNFPALLSTGEFLKLPFERLAFV
LSSNSLKHCTELELFKATCRWLRLEEPRMDFAAKLMKNIRFPLMTPQELINYVQTVDFMR
TDNTCVNLLLEASNYQMMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELRMYD
EKAHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQ
VASLNEKRTFFHLSALKGYLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMSEPHYGHAG
TVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGN
HFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMV
EIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP
Download sequence
Identical sequences ENSFCAP00000020058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]