SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020372 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020372
Domain Number 1 Region: 24-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.02e-21
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 2 Region: 181-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000425
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020372   Gene: ENSFCAG00000029527   Transcript: ENSFCAT00000031741
Sequence length 276
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:20067768:20070346:1 gene:ENSFCAG00000029527 transcript:ENSFCAT00000031741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPAPLLALRPGDTGVGCKKPGAVSFADVAVYFSPEEWGCLRPAQRALYRDVMRETYG
HLGALGFPGPKPALISWMEQESEAWSPAAQDPEEGESLGGALRGGTPNKKEEAPEEGPGA
KGPRKTPGKEPSKELVKHNPDWTVRKVSARAQQPTSAAWNQSTGVQPSVPVPGVDTQDSQ
RRHVCADCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGR
RGRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFEECG
Download sequence
Identical sequences M3X179
XP_011288829.1.62641 ENSFCAP00000020372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]