SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000020873 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000020873
Domain Number 1 Region: 451-727
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-37
Family YWTD domain 0.0000414
Further Details:      
 
Domain Number 2 Region: 125-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 3 Region: 386-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000757
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 4 Region: 211-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 5 Region: 261-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 168-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 90-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 3-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 53-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000020873   Gene: ENSFCAG00000026364   Transcript: ENSFCAT00000023801
Sequence length 743
Comment pep:novel chromosome:Felis_catus_6.2:B1:24579632:24589766:-1 gene:ENSFCAG00000026364 transcript:ENSFCAT00000023801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVPCQNGEECVSQEYLCDGKRDCQDGSDEGNCSHFCNRPDKLSSIKVRVCQNCLNRNQC
IEGKYHCDGAQQCSDGSDELDCWEPTEDCSLRCDNKTRCIPKSWLCDGNPDCSDRKDEQG
CTQVHAKCSTPEFRCKSGQCISNFLRCDGNQDCLDHSDEEGCPVDLPPQCPSGEVRCRRS
GECVSAEWLCDRDVDCEDGTDEKDCDPEELRCGSRQWSCASGERCVPDAWRCDGQRDCGD
GSDEAGCKCRGSRKSSSPGPPEKCQSSEFQCGSRACLDLRLVCDGKEHCPDGSDEGGQCA
WPACSRARCSHACYQSPHGPVSSSSYSSPAAIDLVMSLSVGRLPVCQMKLVLRTFLFSAV
EIECITMFLKLIQVCACERGFELESSGQVCKDVDECQKPGGQPCSQTCVNTEGSYGCTCH
PGYSLEPDGHTCKAAGRAESGSNLAGTEPILLVAIQFSLLLYGLRSLKEDILATVDKNMM
IFSIDYDLVGQKVFWTDVGTESIKWISMDTKKKGTMVKVFFTKRDQSLLIGWKWKGIRSD
CIVVDWIGRNLYWVDGTAGQILAIQLTAVWRGKSEHTIVLDDDVTQPQSLALDPLNGLMY
WSEIGGEPQIEQAGMDGSSRKVLIDQGLGSPTSIALDQFSWKIFWSDDKFHCIGSANLDG
TGITMLQLTRIKSPFSVAVFEDEVFWSEMKTRTVQRMKKTTGKDRAVLIKRSEQPYGLKI
MHEVLQPKSTNPCLDAGCSHLCL
Download sequence
Identical sequences ENSFCAP00000020873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]