SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000021661 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000021661
Domain Number 1 Region: 40-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.48e-36
Family SCAN domain 0.0000659
Further Details:      
 
Domain Number 2 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 743-800
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 800-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.51e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 912-968
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 631-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 856-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 464-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 213-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 11 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 688-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 13 Region: 367-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 953-1003
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000467
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000021661   Gene: ENSFCAG00000021993   Transcript: ENSFCAT00000032219
Sequence length 1030
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:157549083:157567630:1 gene:ENSFCAG00000021993 transcript:ENSFCAT00000032219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMTRENWGHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQ
EALIRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALV
EELQQDLDGPALKVPVLVQDQDILQEGMSTPGAAVPHAPSGSHIAEICQNPFTDPVVFNL
QDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWECLGPIQ
RALYWDVMLENYGNVTSLEWETMTENEEVTPKPSISQRADSQKGTSKRLQGSVPQTLDFE
EECEWQIVASQWGTETGERDTLKKGPLCERDTKKRALPEKQGQKWKEFGESLTLGSALSE
SLIGNEGKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRN
HSGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGE
RPYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFVLKKSLILHQRIHSGEKPYK
CDECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKC
GKIFNSKSNLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVF
ILKKSLILHQRFHTGENLYECKDCGKVFGSNRNLTDHERLHNGEKPYECRECGKTFIMSK
SFMVHQKLHTQEKSYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECNECGRAFSSNRNLIE
HKRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCSDCGKVFSYRSNLIAHQRI
HTGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGE
KPYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYG
CNDCSKVFRQRKNLTVHQKIHTDGKLCECDESEKEFSQTSNLHLQQEIHAVEGFSWLQNA
NESKTEIQKI
Download sequence
Identical sequences ENSFCAP00000021661 XP_003992344.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]