SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Felis catus 76_6.2 > ENSFCAP00000021811

Domain assignment for ENSFCAP00000021811 from Felis catus 76_6.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSFCAP00000021811
Domain Number 1	Region: 216-343
Classification Level	Classification	E-value
Superfamily	Second domain of FERM	1.57e-32
Family	Second domain of FERM	0.0019
Further Details:

Domain Number 2	Region: 357-449
Classification Level	Classification	E-value
Superfamily	PH domain-like	6.39e-25
Family	Third domain of FERM	0.0032
Further Details:

Domain Number 3	Region: 2-78
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	0.0000000000000103
Family	PDZ domain	0.012
Further Details:

Domain Number 4	Region: 127-178
Classification Level	Classification	E-value
Superfamily	Ubiquitin-like	0.00000000827
Family	Ras-binding domain, RBD	0.054
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSFCAP00000021811 Gene: ENSFCAG00000024792 Transcript: ENSFCAT00000027502
Sequence length	450
Comment	pep:novel chromosome:Felis_catus_6.2:X:86859685:86905885:1 gene:ENSFCAG00000024792 transcript:ENSFCAT00000027502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	RQVTIHRDPIYGFGFVAGSERPVVVRSVRPGGPSEDKLLAGDQIVAINEEDVSEAPRERF IELIRSAKEFIVLTVLHTHQSPKSAFISAAKKARLRSNPVKVRFSEQVAVGETDAKMMKK EALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVIVTLQDRLSLRYIEHFALVLEYAGPEQ NHKFLLLQDKQPLAYVVQRTHYQGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDV IRERFGMDPKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKE KNLRKSLSQQLKAHQTHPSSGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLVSEDEKQ SATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVL LMEWPEATNFACLIAGYCRLLLDSRKMVFS
Download sequence
Identical sequences	ENSFCAP00000021811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]