SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022064 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022064
Domain Number 1 Region: 56-193
Classification Level Classification E-value
Superfamily PH domain-like 0.0000113
Family Phosphotyrosine-binding domain (PTB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022064   Gene: ENSFCAG00000024432   Transcript: ENSFCAT00000024471
Sequence length 200
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:135628705:135640664:1 gene:ENSFCAG00000024432 transcript:ENSFCAT00000024471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNTSDTC
AEFRIKYVGAIEKLKFSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGRSLLALKTTDASNEEYSLWVYQCHSLEQA
QAICKVLSTAFDSVLTSEKS
Download sequence
Identical sequences XP_003984561.1.62641 XP_006930551.1.62641 XP_006930553.1.62641 XP_007098279.1.5354 XP_014936607.1.86478 XP_019308053.1.44245 XP_019308063.1.44245 XP_019308065.1.44245 XP_019308069.1.44245 XP_019308075.1.44245 XP_019308081.1.44245 XP_019308088.1.44245 XP_019683503.1.62641 XP_019683504.1.62641 XP_019683505.1.62641 ENSFCAP00000022064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]