SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022209 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022209
Domain Number 1 Region: 3-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-66
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 202-324
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-35
Family Spectrin repeat 0.000000579
Further Details:      
 
Domain Number 3 Region: 438-556
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-30
Family Spectrin repeat 0.00000538
Further Details:      
 
Domain Number 4 Region: 325-433
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-25
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 5 Region: 562-674
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-23
Family Spectrin repeat 0.00000283
Further Details:      
 
Domain Number 6 Region: 667-799
Classification Level Classification E-value
Superfamily EF-hand 1.28e-22
Family EF-hand modules in multidomain proteins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022209   Gene: ENSFCAG00000029959   Transcript: ENSFCAT00000030080
Sequence length 827
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:14673567:14744352:-1 gene:ENSFCAG00000029959 transcript:ENSFCAT00000030080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLG
MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHR
HRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSF
YHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKT
MQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDIN
NGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETA
TLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDA
LGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIE
GLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWE
KVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLE
DQLNHLKRYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIA
RTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVEND
RQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITA
EELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL
Download sequence
Identical sequences ENSFCAP00000022209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]