SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023027 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023027
Domain Number 1 Region: 75-140
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 2 Region: 42-82
Classification Level Classification E-value
Superfamily Elafin-like 0.00000942
Family Elafin-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023027   Gene: ENSFCAG00000031439   Transcript: ENSFCAT00000024423
Sequence length 147
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:15245031:15249533:1 gene:ENSFCAG00000031439 transcript:ENSFCAT00000024423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPAARPVALKMGPLGLVPVLVLFILLGRVQEPELVEGLLGKKCPENKPPCSFKEIDHCGR
KKRCSGKMKCCKFNCAKKCVDPDEDVCSLPKEVGLCLALIPRWWYNKETKRCSKFTYGGC
AGNNNNFQSEAVCRSICPDKRLINSFP
Download sequence
Identical sequences ENSFCAP00000023027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]