SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023112 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023112
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023112   Gene: ENSFCAG00000030527   Transcript: ENSFCAT00000023738
Sequence length 87
Comment pep:novel chromosome:Felis_catus_6.2:D2:51577872:51592477:-1 gene:ENSFCAG00000030527 transcript:ENSFCAT00000023738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRLPRAQIQGSLTFGDVAVAFTQIEWKHLDAAQRALYKDVMLENYGNLVSVGLLSSKP
KLITQLEQGSEPWMEAQQVPSGTCSGE
Download sequence
Identical sequences ENSFCAP00000023112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]