SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023126 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023126
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000275
Family Elafin-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023126   Gene: ENSFCAG00000029157   Transcript: ENSFCAT00000031892
Sequence length 65
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:15532635:15534918:1 gene:ENSFCAG00000029157 transcript:ENSFCAT00000031892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCCYKACFRQCVRKISVKPGSCPEDRLRCLSPIQHLCHQDSDCKGSARCCLGACGRDCR
SPARG
Download sequence
Identical sequences ENSFCAP00000023126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]