SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023133 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023133
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000022
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023133   Gene: ENSFCAG00000028036   Transcript: ENSFCAT00000031760
Sequence length 66
Comment pep:novel chromosome:Felis_catus_6.2:X:27625744:27626061:-1 gene:ENSFCAG00000028036 transcript:ENSFCAT00000031760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRWANICRWTEDRWVLLQDILLKWQRFTEEQCLFSAWLSEKEDALNKIHTTGFKDQSEML
SSLQKL
Download sequence
Identical sequences ENSFCAP00000023133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]