SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023317 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023317
Domain Number 1 Region: 323-605
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-76
Family Kelch motif 0.0000814
Further Details:      
 
Domain Number 2 Region: 8-62,118-182
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023317
Domain Number - Region: 72-109
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0241
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023317   Gene: ENSFCAG00000023585   Transcript: ENSFCAT00000029983
Sequence length 629
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:55534305:55637983:-1 gene:ENSFCAG00000023585 transcript:ENSFCAT00000029983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGVGGQDGLGAPKDQQQQQPQQQPPQQQQPPPQEEPGTPSSSPDDKLLTSP
RAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLND
QISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELALF
QMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMN
YHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDDKKTWKILTIMP
YNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFYA
CRLDKHLYVIGGRNETGYLSSVESYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGGV
HNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVMLV
ECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGTW
TELEGDVAEPLAGPACAPVILPACVPYNK
Download sequence
Identical sequences M3X9L5
XP_006938898.1.62641 ENSFCAP00000023317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]