SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023329 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023329
Domain Number 1 Region: 1268-1372,1433-1586
Classification Level Classification E-value
Superfamily Cullin homology domain 6.8e-39
Family Cullin homology domain 0.0013
Further Details:      
 
Domain Number 2 Region: 831-1023
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-36
Family APC10-like 0.0064
Further Details:      
 
Domain Number 3 Region: 414-488
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.93e-31
Family CPH domain 0.00000761
Further Details:      
 
Domain Number 4 Region: 141-219,527-616,691-818
Classification Level Classification E-value
Superfamily ARM repeat 0.00000351
Family PBS lyase HEAT-like repeat 0.064
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023329
Domain Number - Region: 1604-1703
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00661
Family SCF ubiquitin ligase complex WHB domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023329   Gene: ENSFCAG00000009717   Transcript: ENSFCAT00000027912
Sequence length 1755
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:43767645:43869171:-1 gene:ENSFCAG00000009717 transcript:ENSFCAT00000027912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVPRRNASSRTLESSPSRGPGARMVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHP
EYQIRWLILRRGDDGEGGSSQVDCKAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQEIA
GEAGALDKSVLGEMETDVKSLIQRALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGV
FKDPRVLDLLMHMLSSPDYQIRWSAGRMIQALASHDAGEKQCGEKGRGVGQLRASQDTVA
RASASSVRTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGIQLPQVP
GRLLFSLVKRYLHVTSLLDQLNDSAAEPGAQNNSAPEELSGERGRLELEFSMAMGTLISE
LVQAMRWDWASSKQGPSARSSCSIFQPQLAEAGPGLPPARVRPCIRRSRRFRPRSEFASG
NTYALYVRETLQAGMRVRMLDDYEEVSAGDEGEFRQSNNGVPPVQVLWESTGRTYWVHWH
MLEILGFEEDIEDVVEADENHGAVVSGALGVALPSWRWKPMTELYAVPYVLPEDEDAEES
EHLTQAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPMELAQHLLLA
LPQRLDDSALRDLLNCRVYRKYGPEALAGQPAYPTLPEAQAQPQESADASRANLCNFHFP
VGKEPPTQCPDTPLRRLMEGCGLPGRIFLDLERALSSEGPREMEIKPLLLQLQRQPQPFL
TLMRGLDTPAANKALHLTVLRILMQLVDFPEALLLPWHEAMDACMACLRSPDTDREVLQE
LIFFLHRLASVSRDYAVVLNQLGARDAISKALEKHLGKLDLAQELRDMVFKCEKHAHLYR
KLTTNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSVEMKEDKCWEKVEVS
SNPHRASKLTDRNPKTYWESNGSAGSHYITLHMHQGILVRQLTLLVASEDSSYMPARVVV
FGGDSTNSLNTELNSVNVMPSASRVILLENLTHFWPIIQIRIKRCQQGGIDTRIRGLEVL
GPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRQEQNFADR
FLPDDEAAQALGKTCWEALVSPLVQNITSPDEDGISPLGWLLDQYLECREAAHNPQSRAA
AFSSRVRRLTHLLVHVEPCEAPPPAVATPRPKGRNRSHDWSSLATRGLPSSIVRNLTRCW
RAVVEEQVNNFLTSRWRDGDFVPRYCEHFHNLQKSSSELFGPRAAFLLALQNGCAGALLK
LSFLKAAHVSEQFARHIDQRIQGSRIGGARGMEMLVQLQRCLETVLIFSGLEIATTFEHY
YQHYMADRLLGVGSSWLEGAVLEQIGPCFPNRLPQQMLRSLSMSEELQRQFHVYQLQRLD
QELLKLEDTEKKIQGGHEASDREHKREKAEEAEGAGAAAATDVAGEEEEDEEEDEDLYYE
GAMPEVSVLVLSPRCWPTASICHTLTPRTCLPAYLRGTLNRYSNFYNKSQSYPALERGPQ
RRLQWTWLGRAELQFGDQTLHVSTVQMWLLLYLNDLKAVSVESLLALSGLSPDMLNQAIG
PLTSSRGPLDLQEQKDVPGGVLKIRDGSEEPRPRRGNVWLIPPQTYLKAEDEEGRNLEKR
RNLLNCLIVRILKAHGDEGLHIDQLVCRVLDAWQKGPCPPRGLVSSLGRGSACNSTDVLS
CILHLLSKGTVRRHDDRPQTLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGV
PYASCTGTQSFSTFR
Download sequence
Identical sequences ENSFCAP00000023329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]