SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023677 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023677
Domain Number 1 Region: 623-723
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000533
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023677   Gene: ENSFCAG00000030849   Transcript: ENSFCAT00000024744
Sequence length 768
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:84905928:84929197:1 gene:ENSFCAG00000030849 transcript:ENSFCAT00000024744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGEEKAEVEAPADTKALSYGQWSCREREVDTPGLTSGEQEQPPHLEAEGGLASPVWGT
EGLPAPACCDRAGPSPSGAYQPQANNTRREPVAGRSKPALGCLLPSAGPGTGDLLHSVES
QMEETRLSASEELPQTLTVPRATGLCSGHDADTEDDPSPVESPRALDLSRQPHSSGFPFP
TRWRSVVSQGTAVPQFSSRSVSASSPGGSLQGHQEKAEPQSCSIAKVSSSLELATPHSAP
SVGSGPRLQWSPQPASSGVDAPGLGRRRLSFQAEYWACVLPDSLPPSPDRHSPLWNPNKE
YEDLLDYTYPLRPKPHLPKHLDSHVLADPVLQDSGVDLDSFSVSPASTLKSPTNGSQNCP
SAEASALPFSRPGDPGLRRWSSGIPQKQGSVGLASCNQLTSTPRAPGGRDAPWESREPAP
RGVKDWLGYMGKHPEAGSPQRRTWERGWPLPRTEREKGASQGVWHPACTESGWKPEEEVE
SDDEYLALPARLTQVSSLVSHLGSIPTLVTLPTGAAEGQTSLDVSDSDGPASLPSDSSQS
QLPSEAALRGSRGPEGQNHRLLCSFIHARGSAGEGGLGNSQALGVSSGPLRAHSSLPAVW
DRHAFLDLDAAGQPPGKGEPGKESLVQCVKTFCCQLEELIRWLYNIADVTDHLIPSKSNL
TGLKSSLQLYRQFKKDIDEHQSLTESVLQKGEILLQCLLDNTPVLKDVLGRISKQPSELE
SHADRLYDAILASLDMLAGCTLIPDNTPVAHRSTDVKGISLASSKAEM
Download sequence
Identical sequences M3XAM3
XP_006930204.1.62641 XP_019682850.1.62641 ENSFCAP00000023677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]