SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023770 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023770
Domain Number 1 Region: 654-808
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-34
Family MAM domain 0.00079
Further Details:      
 
Domain Number 2 Region: 969-1133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.55e-32
Family MAM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 61-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-29
Family MAM domain 0.01
Further Details:      
 
Domain Number 4 Region: 811-966
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-28
Family MAM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 269-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-17
Family MAM domain 0.018
Further Details:      
 
Domain Number 6 Region: 488-643
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000301
Family MAM domain 0.019
Further Details:      
 
Domain Number 7 Region: 224-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 8 Region: 454-493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023770
Domain Number - Region: 25-50
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0127
Family LDL receptor-like module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023770   Gene: ENSFCAG00000025055   Transcript: ENSFCAT00000032191
Sequence length 1214
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:95092761:95100453:1 gene:ENSFCAG00000025055 transcript:ENSFCAT00000032191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPRHLLLALLLAAGPPGRAWVPNDCRAPSEAACNFVCDCPDCSDEAQCGYHGVSPAPG
APFACDFERDSCGWRDISTSGYRWLRDRAGATLEPLGPRSDHTLGTDLGWYTAVGTHRGK
EASTAALRSPVLHDAAPTCELRLWHHTATGDVAELRLELTHRAETLTLWQSSGPWGPGWQ
ELVVATGRIRGDFWVTFSATRNATHRGTVALDDVVFRGCGLPSPQARCPLGYHHCGNMAC
VEPHQLCDGEDNCGDGSDEDTPACRRHTATDFETGLGPWNHSEGWARNHSAGPRPPAWPR
RDHSRNSAQGSFLVSVAEPSAPAVLSSPEFQASGPHNCSLIFYHYLHGSEGGCLQLFLQI
QSPGSPQGPVLLRRRHGELGAAWVRDRVDIQSEHPFRILLTGHTGPGGVVSLDDLILSDH
CQPVPVPTEASGSPPGLWAAAPWRQPSSLRPRDFCEPGHLSCGDLCVPPEQLCDFQQQCE
GGEDEQDCGTTDFEPLTGGGWEDASVGRLQWGRLLAQESRGPGAGARRTAAGHFLALQRA
WGQFAAEARVLTPPLGPSGPRCELHMAYYFQSHPQGFLALVVVEDSNRELVWQAPGSSQG
WRMDRVFLGARRRPFRLEFVGLVDLDGPGRQGAGVDDVTLKDCSPVTATEKDSEVSCNFE
RDTCGWYIGHLTDAHWRRIQSHGPGYDHTTGRGYFLLLDPTDPPAGPGAHLLTQPQVPTA
PQECLSFWYHLHGPQIGTLRLVLRREGEADTLLWSRTGTHGNHWHEAWATLHHQPGSGTK
YQLLFEGSRDGYHGTMGLDDVALRPGPCWAPRRCSFEDSACGFSGAQGLWTRQPNATGHA
AWGPADHTTGTAQGHYMVVDTSPQALPPGHVASLTSEEHQPLARPACLTFWYHLSLRNPG
ALQVHVGEAERQQVLSISAHGGSAWRLGSVDVQAERAWRVVFEAVATGVEHSYIALDDLL
LQDGPCPRPASCDFEAGLCGWSHLAWPGLGGYSWDWSSGAAPSRYPQPLVDHTLGTETGH
FVLFETHMLGPGGQAAWLHSQPLPATEASCLRFWYHMGFPEHFYKGQLRVLLNSARGQLA
VWSMGGRLRHQWLLGQVEVASAEEFQIVFEATLSGQPAVGPIALDDVEYLDGRHCQLSAP
GRGDTVVATSVPAAVGGALVVLVLLVLLGLAGRRWLQKGGCPSRGETAAVAPGFDNIVFN
ADGVTLPASLTDSQ
Download sequence
Identical sequences ENSFCAP00000023770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]