SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024651 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024651
Domain Number 1 Region: 855-936
Classification Level Classification E-value
Superfamily DEATH domain 9.89e-22
Family DEATH domain, DD 0.00000838
Further Details:      
 
Domain Number 2 Region: 155-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000046
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000854
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024651   Gene: ENSFCAG00000013047   Transcript: ENSFCAT00000026013
Sequence length 945
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:34493942:34512809:1 gene:ENSFCAG00000013047 transcript:ENSFCAT00000026013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRARTGVSKAQALQSLQPHEAHLPSTGTDSGSEVLPDSFPSAPAEPLPHFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVMQEGLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDQEVLLQCRPPEGV
PVAEVEWLKNEDIIDPTQDTNFLLTIDHNLIIRQARLADTANYTCVAKNIVAKRRSTTAT
VIVFVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVQNKKTL
SDPKSHLLETSGDVALYAGLVVSIFVVVGVVMVVGVVVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPNNPQLLHPSVPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPSL
KIKVYNSSTTGSGPGLPDGADLLGVLPPGTYSGDYTRDAHLLHLRSASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAENTLPLSEGTQTV
LSPSVTCGPTGLLLCRPIILTVPHCAEVRAGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEARSCHILLDQLGTYVFTGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELSCKICVRQVEGEGQICQLHTTLAETPAGSLDAFC
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
Download sequence
Identical sequences ENSFCAP00000024651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]