SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024727 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024727
Domain Number 1 Region: 178-301
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.92e-60
Family Dystroglycan, domain 2 0.000000314
Further Details:      
 
Domain Number 2 Region: 494-595
Classification Level Classification E-value
Superfamily Cadherin-like 6.75e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 59-157
Classification Level Classification E-value
Superfamily Cadherin-like 2.98e-17
Family Dystroglycan, N-terminal domain 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024727   Gene: ENSFCAG00000026964   Transcript: ENSFCAT00000024133
Sequence length 892
Comment pep:known chromosome:Felis_catus_6.2:A2:18184635:18205653:1 gene:ENSFCAG00000026964 transcript:ENSFCAT00000024133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSSGLSLLLPLWGRTFLLLLTVAVAQSHWPSEASRDWENQLEASMHSVLSDLHEAVPT
VVGIPDGTAVVGRSFRVTIPMDLIASNGELIKVSTAGKEALPSWLHWDPQSHTLEGLPLD
TDKGVHYISVSTARLGANGSHVPQTSSVFSIEVYPEDHCEPQSVRAASPDPAEVVSSACA
ADEPVTVLTVILDADLTKMTPKQRIDLLHRMQSFSEVELHNMKLVPVVNNRLFDMSAFMA
GPGNAKKVVENGALLSWKLGCSLNQNNVPDIRGVEAPAREGTMSAQLGYPVVGWHIANKK
PPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVP
GKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTT
TKKPRISTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRIRTT
TSGVPRGAEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQ
QLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDR
APARFKAKLMGDPAPVVNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTNNT
LPLEPCPKERIMGLSRRIAEDDGKPRAAFSNALEPDFKATSIAVTGSGSCRHLQFIPVAP
PKRVPSEAPPTDVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKL
TLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLN
QDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences B4XEM8
ENSFCAP00000009236 NP_001124311.1.62641 XP_006928808.1.62641 9685.ENSFCAP00000009236 ENSFCAP00000024727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]