SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024728 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024728
Domain Number 1 Region: 27-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-22
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 303-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000024728
Domain Number - Region: 392-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00301
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024728   Gene: ENSFCAG00000023800   Transcript: ENSFCAT00000027778
Sequence length 456
Comment pep:novel chromosome:Felis_catus_6.2:E3:4427543:4449452:-1 gene:ENSFCAG00000023800 transcript:ENSFCAT00000027778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYAFPGFDALPSTTENEQIAKCAGLGSVSFKDVTVDFTRDEWLQLTGTQRTLYRDVMLE
NYSHLVSVGCRLTKPEVIFKLEQGEELWPSRGESPDQGDQDRSQENQDKCLWRVSLINKK
SLTKKRDNVCRKAPCEYDSCGKSLKNVSESVISDKSHSSRNSDEITACEKFLFDNNQENI
PTGKKSDAHSQDRKSLSQTQDLTEQHKIQTLGLLFEDDECGETFLNKSAIIPPTRAQTEE
KSPDCTEHGGNISDESARQVLQETHTRKSHSEVKECEKSALLKHQKVNVEEKTQESNENE
NNFSKKSHLTQPPATHTGEKIFECSHCGKCFYQESHLTQHQKIHTGEKPCESNKCGKTFQ
KSQPTDPPGSHPGEKPSECDTAPVQLAPPGQQRTQSERRLYVCSECNKSFRQLCPQNPSE
DSHRREALSVYEVWEILLRKIKLQSSSEDSHGGETL
Download sequence
Identical sequences ENSFCAP00000024728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]