SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025024 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025024
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025024   Gene: ENSFCAG00000028466   Transcript: ENSFCAT00000031162
Sequence length 160
Comment pep:novel chromosome:Felis_catus_6.2:D2:52308548:52310631:-1 gene:ENSFCAG00000028466 transcript:ENSFCAT00000031162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INQICVLQGSISFEDVTVNFTQEEWGQLDPDQRTLYRDVMLENYGIFISLGHTITKPEEI
FKLEQEASWILEEEFASQCYLRIILVDGMVESKENQDRHLWQDAFINNKKVITQRENVLS
PSRKMSSKYNLDGIGLKNMSELPTSNRNYSGKKSDDANGR
Download sequence
Identical sequences ENSFCAP00000025024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]