SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025575 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025575
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000317
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025575   Gene: ENSFCAG00000022029   Transcript: ENSFCAT00000031514
Sequence length 90
Comment pep:novel chromosome:Felis_catus_6.2:X:26746658:26767210:-1 gene:ENSFCAG00000022029 transcript:ENSFCAT00000031514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKDSTQWLEAKEEAEQVLGQARAKLESWKETPYTMDAIQKKITETKQLAKDLRQWQINV
DVANDLALKLLRDYSSDDTRKVHMITENIN
Download sequence
Identical sequences ENSFCAP00000025575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]