SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218898863|ref|YP_002447274.1| from Bacillus cereus G9842

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218898863|ref|YP_002447274.1|
Domain Number 1 Region: 180-465
Classification Level Classification E-value
Superfamily Subtilisin-like 3.01e-36
Family Subtilases 0.00058
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.31e-32
Family Collagen-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218898863|ref|YP_002447274.1|
Sequence length 613
Comment subtilase family serine protease [Bacillus cereus G9842]
Sequence
MKIFQKMYASTVIITTLLGTGGTINSVHADSIEQQSKLGIEQETDKQIIVKFKADLDFPY
EDGIEKQIQSQTNDKVIKDLLTEYPDVTFTRLFTSVSPEQIQNLEVKAPNHVSTSLLNYY
ILQNQNSGYEEEIVDKLKASSLIEDAYMKKQEKIMPPEVQSSSVALNPNKNPRFKKQGYL
EAAPYGINAPFAWGVQGGNGNGITFVDMEYGWLLNHEDLLHQNIELMSGRNINQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGIVIIEAGANGWNDLDQFKDRKGKQVLNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNQSTGTKSKDPYADKIGVLPD
LKSILVNLGYEQRKLNGGNELQVTENEPNNEPRQANKVNFHTPVKGTLHNSDRVDVFTFQ
IDSPENINISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYNAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences A0A243M9R5 A0A2B1T8U1 A0A2H3Q9E6 B7ITL5 J8CRS7
WP_000689210.1.35769 WP_000689210.1.36279 WP_000689210.1.48759 WP_000689210.1.50042 WP_000689210.1.61799 WP_000689210.1.6241 WP_000689210.1.73638 WP_000689210.1.83666 WP_000689210.1.9703 gi|218898863|ref|YP_002447274.1| 405531.BCG9842_B1437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]