SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FGSG_05174T0 from Fusarium graminearum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FGSG_05174T0
Domain Number 1 Region: 233-661,694-770
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.62e-197
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 6-232
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.96e-63
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FGSG_05174T0
Sequence length 913
Comment | FGSG_05174 | Fusarium graminearum ribonucleoside-diphosphate reductase large chain (914 aa)
Sequence
MFVRKRDGRQERVQFDKITARVSRLCYGLDMNHVDPVAITQKVISGVYGGVTTIQLDDLV
SGVCTMTVVTSANPILQAAETAAYMTVTHPDYAILAARIAVSNLHKQTKKQWSAVVSDLY
HWVNPKNDRASPMISKETYECVMRHKEELDSAIVYDRDFNYNYFGFRTLSRSYLLQIDGK
IAERPQHMIMRVAVGIWGDDIERVLETYNLMSSKFFTHASPTLFNAGTPQPQLSSCFLVD
MKEDSIDGIYDTLKTCAMISKMAGGIGLNAHRIRATGSYIAGTNGTSNGIVPMLRVFNNT
ARYVDQGGNKRPGAFAIYLEPWHADVFEFLDLRKNHGKEEVRARDLFLALWIPDLFMKRV
ERNGEWTLMCPNECPGLADCYGDEFEALYEKYEREGKGRKSIKAQKLWYAILEAQTETGN
PFMLYKDHCNRKSNQKNLGTIRSSNLCTEIIEYCAPDEVAVCNLASLSLPSFINYEDACY
DFKKLHEVTQVVVRNLNKIIDVNHYPVQEARNSNMRHRPIGLGVQGLADAFLALRMPFES
PEARELNKQIFETIYHAALTTSVQLAKEEGPYSTFKGSPASEGILQFDMWNVKPSDLWDW
EPLREDVKTHGIRNSLLVAPMPTASTSQILGNNECFEPYTSNIYQRRVLAGEFQVVNPWL
LKDLVDMGLWSDAMKNRIIADNGSIQNIPNIPAEIKALYKTVWEISQRQVVQMAADRGAF
IDQSQSLNIHMKDPTMGKITSMHFAGWKLGLKTGMYYLRTQAAAAPIQFTVDQENLKIAD
SNSASIKPLGKRAPPAGSSYLMSSSTAMGQTNGNRTGSQGNGTNGSSANGVTASTSVPGR
APVIKADVAEGDSPKALPTEPAEKVQEEELGMKKNPQSEDQGADNEDRERDIYSEAVLQC
SIEDPESCIMCSG
Download sequence
Identical sequences I1RMI4
XP_011323678.1.100342 5518.FG05174.1 FGSG_05174T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]