SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FGSG_06174T0 from Fusarium graminearum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FGSG_06174T0
Domain Number 1 Region: 251-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-30
Family PDI-like 0.029
Further Details:      
 
Domain Number 2 Region: 37-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.39e-18
Family PDI-like 0.02
Further Details:      
 
Domain Number 3 Region: 400-513
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000119
Family PDI-like 0.064
Further Details:      
 
Weak hits

Sequence:  FGSG_06174T0
Domain Number - Region: 618-670
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0432
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) FGSG_06174T0
Sequence length 747
Comment | FGSG_06174 | Fusarium graminearum conserved hypothetical protein (748 aa)
Sequence
MRFSPLATLAGLSAFVLADEVKNPVSEPSVFNGKTVPPLLELTPANWEEQTKKNKFLMVK
HFSPYCKHCTRFAPTFQTLYEFYYTSKPQVDDPEATFTKYYDFVFGTVNCVAYYDFCMEH
EIQSYPTSILYEDGKVFESLRGIKNMTVLTTTVEKALAKTHPGRPELVELPNPGDKVYPA
PKTDEKPAESATEKKEAEAPAKAAAEAEKPLDAVAEKVASEPSGKTEGKSLDDVTKMPKD
EDKSDKAEAVEKTAQDENKHSFGADWKVPSTGQMLKKPKAQDSTPKYNLEGISAPLTPAN
FDTLVTNSKDPWFIKFYAPWCSHCKAMAPTWQQLAKKMQGKLNIGEVNCEADHKLCTQMG
VKAFPTIHFINGAEKAEYKGLRGVGDFVAYAEGALEVAGGVLDVDAESFKELEKTEEVLF
VYFYDHATTTEDFKALDALPLNLIGRGKIVKTSDPELYSRFKITTWPRLLVSREGRATYY
TPITPDEMRDVDALVSWMKSTWLPLVPEMTAINAKQIMNHKLVVLAILNRDDEDRLQNSI
LELKNAANEWVDRQVQEFQLERKKLRDAKQMRIEEAQSRDDQRGLRNAKAIKIDMDSTRR
QEVGFAWVDGIFWQRWIASTYNIDVRDGERIIINEEDRHKFWDTTPTGNQIMVSHTSIMD
TLDKIVYGPNPISPKYTISSFAKFFFDIKMNFVDHPFLSIGFVIAVSFGLYSWFRNRTRR
SRGTFFRDDNMGLKDGLLGQNGNAKSD
Download sequence
Identical sequences A0A2H3G1R9 I1RQ38
XP_011324812.1.100342 5518.FG06174.1 FGSG_06174T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]