SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60679906|ref|YP_210050.1| from Bacteroides fragilis NCTC 9343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60679906|ref|YP_210050.1|
Domain Number 1 Region: 374-705
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.59e-49
Family beta-glycanases 0.0014
Further Details:      
 
Domain Number 2 Region: 711-806
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000695
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.057
Further Details:      
 
Weak hits

Sequence:  gi|60679906|ref|YP_210050.1|
Domain Number - Region: 116-214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0752
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|60679906|ref|YP_210050.1|
Sequence length 808
Comment carbohydrate-binding protein [Bacteroides fragilis NCTC 9343]
Sequence
MNEHKHNYNMKINCLLALALSASSLAAQDAVIRVDAGKVENKITPYLYGACMEDVNHEIY
GGLYDQKIFGESFEEPVSMDNFIGFTRCEGVWKLQDGQLSVQAHPGAKLVYDDTQLSDGT
VGVDLKFTNGTSSSNNAGLLLRVGEYGGGADNFDGYEVSLFADGKRLLLGKHLHNWQELK
TTPVDVDPMQWNRMEVKLDGDELVILLNDCEVLRFEDRDTGLRNGKVAFRNWGADVSYRS
LTIGSNTPVKLLTKATPQVSGMWDAFADLTAAAVYKQIADKPFHGRYAQEIEYLVGTGKV
GIANRSLNRWGISVRQGEKKTGSLYLKGKAEVRVALQSVDGEKEYAVQCIRANAGDWKKY
TFELTPDKTDENARLAIYLEEKGRIQVDMVTLMNGADRQFCGLPLRNDIGQAMVDQGLRF
LRYGGTMVNAPEYRFKKMIGDRAERPPYKGHWYTYSTNGFGIEDFLHFCEKAGFMPAYAV
NVEESAQDMADMIEYLNGSVDTKWGKKRAENGHPEPYGLKYLEIGNEEVIWGDIEADYQH
YIDRFNDIYEAVHAKDPEVQFIHSAWWRPESPNMEKVFKALDGKAAYWDYHPWTDDLGSH
VNIDRELTDMKAKFLKWNPKTSMRCAIFEENGNLHNVQRAIVHATVQNVVRRHGDFILTT
CAANALQPYLQNDNGWDQGQIFFTSGQVWGMPTFYAQQMSSAHHHPLRLWSETVGELDMT
ATTNEARDEVILHVVNTSSEVRETQVSLSGFIPKGNMEIYTLSGELNDENLPDTPTWILP
KATWKQAPGSDFTYSFPGYSYTIVVLKK
Download sequence
Identical sequences Q5LID8
NYSGXRC-12024a 272559.BF0317 gi|60679906|ref|YP_210050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]