SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60680191|ref|YP_210335.1| from Bacteroides fragilis NCTC 9343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60680191|ref|YP_210335.1|
Domain Number 1 Region: 20-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-39
Family Glycosyl hydrolases family 16 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|60680191|ref|YP_210335.1|
Sequence length 307
Comment endo-beta-galactosidase [Bacteroides fragilis NCTC 9343]
Sequence
MNTTGRLSFHPSEIPTVFKSPITGRTYHLVFNDEFDDGVIDTLKWDTRSRRSPFTRRGMY
QEKPYYVLCHEDWTKELHGELRLEVSKYPTQNNVVMTGGILSLGRFMARYGYYETKASFR
DCIGEGYWPAFWIHFDEADKYGKGTEIDVFEYIPKDKQIFQTLHWYKKQAMEEQQSEVQH
AALDYDKSGQFKEHRSSTKYFVLDEAQSKEHTFAVEWTPEELIFYTDGKVTRRVNRKDDP
KQVPSAYQMVYFSCSAGEWGGNVMENQVPAYVYFDYCRCYQESDQDAIYTVKGNGMKVPA
SRRVGKL
Download sequence
Identical sequences E1WL93 Q5LHK3
gi|375357035|ref|YP_005109807.1| gi|60680191|ref|YP_210335.1| NYSGXRC-11268b 272559.BF0629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]