SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60682877|ref|YP_213021.1| from Bacteroides fragilis NCTC 9343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60682877|ref|YP_213021.1|
Domain Number 1 Region: 188-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.48e-17
Family Clostridium neurotoxins, the second last domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|60682877|ref|YP_213021.1|
Sequence length 393
Comment hypothetical protein BF3415 [Bacteroides fragilis NCTC 9343]
Sequence
MKCNVSYKYLFIAIGILCPLFSACDYADGEGSGSENAVYMETPDNKGIVNFTLEPDGGIT
YLTPRLANISQSPVTIQVGYDKEALDKYNKDNGASYEPLPPSAFKLADAEGNELSASEGI
RVPAGDFSAKIMVKVGQLNSKDFPDSKKYAIPLSITGASNYSLIPSQRSAILLLNRSILS
SVAKVSGGEGIRIKPVGMHTKAEWTIQMSAIYSSLTRSNLTTAYLSNGTGGAFYTRISST
AGIQVKNGRDGDDTWTQMPLQAGKWLHITYVHKDKKTTVYVNGKVQKVFENSAITFGENS
MIVVGNSGYRNDYLREIRLWDKALTESEINDYLYLPMDPATPHLISYLPLSKEMETKDLK
APAGTENVTTKARIEYVENVKFPADELVIVNQE
Download sequence
Identical sequences A0A015TKZ9 A0A139T3Y6 A0A149N3A0 Q5L9X0
272559.BF3415 gi|60682877|ref|YP_213021.1| WP_010993402.1.21908 WP_010993402.1.30158 WP_010993402.1.37052 WP_010993402.1.37988 WP_010993402.1.38746 WP_010993402.1.58084 WP_010993402.1.6251 WP_010993402.1.95750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]