SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|60683739|ref|YP_213883.1| from Bacteroides fragilis NCTC 9343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60683739|ref|YP_213883.1|
Domain Number 1 Region: 112-409
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.16e-90
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000109
Further Details:      
 
Domain Number 2 Region: 408-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000791
Family Glycosyl hydrolases family 32 C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|60683739|ref|YP_213883.1|
Sequence length 548
Comment glycosylhydrolase [Bacteroides fragilis NCTC 9343]
Sequence
MHLTTKLFFTATLLAGNLFASFAGDVTLKITKKYINLPVSHQVDRKKMTFEVKGTPERNF
VIRLADEKPDYWVFCDVSSWKGKTLRISYEGESAGLEKIYQDDVIAGQDSLYAEKNRPQF
HFTTRRGWINDPNGLVFYEGEYHLFYQHNPYEREWENMHWGHAVSRDLVHWEELPDALHP
DELGTIFSGSAVIDYDNTAGFNKKNEPALVAAYTVDNPEKQRQCIAYSLDKGRTFTKYEG
NPVIDSKAKWNSKDTRDPKVFWYAPGKHWVMVLNERDGHSIYNSADLKNWEYKSHVTGFW
ECPELFELPVDGDKNHTKWVMYGASGTYMLGSFDGQTFTPEAGKYYYYTGSMYAAQTYSN
IPAGDGRRIQIGWGRISHDGMPFNGMMLLPNELTLRTTSKGVRLFSVPVRETEQLFQPVG
NWTSLSSDAANQRLQAFSGKDCLRIRTTIKLSHATSAGLNLYGQPLVDYDMNSNLINGVF
YSPDDRTSMELTADIYIDRTSIEVFIDGGAYSYSMKRSPREGNREGLHFWGNNIEVKNLE
VFSVKSIW
Download sequence
Identical sequences A0A139TFY5 A0A149NNA3 Q5L7F8
272559.BF4327 gi|60683739|ref|YP_213883.1| WP_010993813.1.37988 WP_010993813.1.58084 WP_010993813.1.6251 WP_010993813.1.95750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]