SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Afum_A1163:AFUB_050780.t1 from Aspergillus fumigatus A1163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Afum_A1163:AFUB_050780.t1
Domain Number 1 Region: 305-392
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000134
Family Ras-binding domain, RBD 0.021
Further Details:      
 
Domain Number 2 Region: 423-525
Classification Level Classification E-value
Superfamily PH domain-like 0.00000493
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Afum_A1163:AFUB_050780.t1
Sequence length 875
Comment gene=AFUB_050780 DS499597:join(507577..507718,508750..511235)
Sequence
MTDAGTQPGCTTRSQMNIQDEIQFNITLERAEVAGCVISHYVNHPTVAMAMETQTTSMEA
GPDQGSLKFSRYRSVRRAATQKQPKQLNTSIPPAPSLPSAPATGLHYGTTPTADSINRSM
SRYRRQRAPTAPAMAAQPAAPALPTHKTQLNGHDPLRIPEQQAVAATAAHVPAMARSMTE
PTKTTTNPFGDNAAATEDSEAERERHRQEAMARLTGETIKPAPAVSDHRRVTPRTAEGRR
RHDDVQESSRRHHRSDEASEPKRRSLKDKMKLVKPKDRSNTESSAVKSPEPPTGNHFTGV
DAPISAVNSGKRSVLVQYGRMSTKMPVMPSTRVHDLLVAASACLTSEIDPPRFIMMESFS
QLGLERPLRRYEYVRDILNSWAYDGENALIIVPAASIESLRPLEAQNVPIAPPADVTVHI
YYSQRPRKWDKRFVTLRSDGQVTVSKKEHGKDQMNACHLSDFDVYSPTPDFLKKNVDPPK
KICQAIKSQQKSSMFLSTENFVHFFSTNDRAVAEQWHQAVQTWRSWYLVHKKGAAQSEDD
EEAKSLHQQRVGSSHSKSSHPPQFKPLVDLESVAEQEQASSQHSSPDDQQKSSKTKDIFS
RPRRSRERGPPPSSFPKSLAESDTATQPTDGSPFASSGLLGRTYTQRQQAMKEREEREKR
ANEEPFIAHGLVGSMCTRRGPVSQPASRSNTMTSAQAPDMGAGAVKRSLSVNRSKPLVDL
TPVYQEPPQHARKGRGVAVEPGVPLIDAATGPEPVGGAIPIPPSTTWRRPPVPPEPLSTT
ETQTRKRSNTIRSTSNQRHQHTAPASPASPVDNAQPSEGPFLANSLLARSAQLAVAQSSV
PVGHGVATGDRNASKPMLDLTPPNPFAEGSLLRNL
Download sequence
Identical sequences B0Y2A6
Afum_A1163:AFUB_050780.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]