SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FOXG_09771T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FOXG_09771T0
Domain Number - Region: 166-215
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0523
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) FOXG_09771T0
Sequence length 261
Comment | FOXG_09771 | Fusarium oxysporum f. sp. lycopersici conserved hypothetical protein (262 aa)
Sequence
MSVTSKFVSDATVQEHASICKSGADSTVRPVAEQQDTDPSVHAVSSKILDIIFEYALNKF
SDSKERLEAANKAYKVFGILPDKAEEIALDRLNTMCIRIGEIYQPGAQCTIISDGVVYND
LLSIPDRDTWAYGQALRELASKKGLQHISFSRIRDLVDLPLPAEMHEIAYVANATNFRRA
LLNRFGKDDIDIDKEIEKDPDTKMTYLGYRRFLESDLKHIFPVGNGRTANAYRRDVRYLA
KQMLIRGYQAENGPVLQREST
Download sequence
Identical sequences A0A0D2Y0I3
FOXG_09771T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]