SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FOXG_09656T0 from Fusarium oxysporum f. sp. lycopersici 4286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FOXG_09656T0
Domain Number 1 Region: 352-395
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000811
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FOXG_09656T0
Sequence length 557
Comment | FOXG_09656 | Fusarium oxysporum f. sp. lycopersici conserved hypothetical protein (558 aa)
Sequence
MATSRPKHIEPEHLRFEFLLRHVDDEPSIADTRSLTEAVRRIIQTAVNFAVVGEVDGATR
LLETLTIRGIDPFQYSDFEYPFLKPCMFFAWEATSSWPSWVPEEERAEGKLQELEAEGRK
HWLERFSQEWEVTDETAEKALDMAYNGLTTKLPDYNGTLAGQVIQAEAMAVNGDFSYSAS
PNGPMAIRYMKIAMWWRQGIFPYPFVQLYRTAGLMIALDIYLRLGKDEKARELFMKVCDR
FHTEEQVEQLACSRAAWKQTLAVPERPLLDFLNIHAAKLRPAVSRACQMAENRLQGGPRR
RYAGQSIEKLVHIISENTFKNCPYDRLDAYRPPGNLRDRPRNANALIRRGCYVAGIRALE
QRLGVTLPEDYKEFLSITNGLDSMWDGQNLVDYLAAAQEVNWQEIDFLEGNELPLLNDGE
PLAWTKNILEWPKVEKPRCISLSGDISHEERAGHFFLIGQDLLQPAKDYFFKTYEERDEV
QRRELDRLVEETYGSMENFRNLEWGFISWTAWDFTVYPYHGLQDFLEQMAEASLRQERPW
LNMFEPRFRRTANVDDA
Download sequence
Identical sequences A0A0D2Y068
XP_018247023.1.49799 FOXG_09656T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]