SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73668176|ref|YP_304191.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|73668176|ref|YP_304191.1|
Domain Number - Region: 48-143
Classification Level Classification E-value
Superfamily Aquaporin-like 0.0719
Family Aquaporin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73668176|ref|YP_304191.1|
Sequence length 216
Comment cytochrome c-type biogenesis protein [Methanosarcina barkeri str. Fusaro]
Sequence
MAYEVISPVAAFGAGIISVLSPCILPLLPAVLATSAGKNRLRPLAIVLGVSISFTIMGVA
TSAFGAVFSAYTDQLKILAEVLILVLGFALLFDISLFNAFSKFPLMGKMGDEGPVSGFLL
GLSLGVLWIPCVGPILGSILTMVALEGNAITGALTLLVYSLGFAIPMLLLAYSAHFSSSK
IRLISKWDVVFKKGAGTILVLFGLYMIYQNHYQWFV
Download sequence
Identical sequences A0A0E3QJI6 Q46ET1
gi|73668176|ref|YP_304191.1| 269797.Mbar_A0632 WP_011305661.1.36239 WP_011305661.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]