SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73668361|ref|YP_304376.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|73668361|ref|YP_304376.1|
Domain Number - Region: 25-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0459
Family RING finger domain, C3HC4 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73668361|ref|YP_304376.1|
Sequence length 78
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MNSTKSCEVRCTKCKKWFSSQIIQFEDEESFLHSIMYKNTEECPHCKAMVTHDKEIMRFV
EKDSNGEVIKETRYIYDF
Download sequence
Identical sequences A0A0E3QJ41 Q46E96
WP_011305846.1.36239 WP_011305846.1.74748 269797.Mbar_A0819 gi|73668361|ref|YP_304376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]