SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73668432|ref|YP_304447.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668432|ref|YP_304447.1|
Domain Number 1 Region: 284-569
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.62e-146
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000029
Further Details:      
 
Domain Number 2 Region: 5-283
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 4.32e-145
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73668432|ref|YP_304447.1|
Sequence length 570
Comment methyl-coenzyme M reductase, alpha subunit [Methanosarcina barkeri str. Fusaro]
Sequence
MAADIFSKFKKDMEVKFAQEFGSNKQTGGDITDKTAKFLRLGPEQDPRKVEMIKAGKEIA
EKRGIAFYNPMMHSGAPLGQRAITPYTISGTDIVCEPDDLHYVNNAAMQQMWDDIRRTCI
VGLDMAHETLEKRLGKEVTPETINHYLEVLNHAMPGAAVVQEMMVETHPALVDDCYVKVF
TGDDALADEIDKQFLIDINKEFSEEQAAQIKASIGKTSWQAIHIPTIVSRTTDGAQTSRW
AAMQIGMSFISAYAMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGHL
SDIVQTSRVSEDPAKIALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNT
YYDVDYINDKYNGAATVGKDNKVKASLEVVKDIATESTLYGIETYEKFPTALEDHFGGSQ
RATVLAAAAGVACSLATGNANAGLSGWYLSMYLHKEAWGRLGFFGFDLQDQCGATNVLSY
QGDEGLPDELRGPNYPNYAMNVGHQGGYAGIAQAAHSGRGDAFTVNPLLKVCFADDLLPF
NFAEPRREFGRGAIREFVPAGERSLVIPAK
Download sequence
Identical sequences A0A0E3QFW5 P07962
WP_011305916.1.36239 WP_011305916.1.74748 gi|73668432|ref|YP_304447.1| 269797.Mbar_A0893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]