SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73668436|ref|YP_304451.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668436|ref|YP_304451.1|
Domain Number 1 Region: 186-432
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.8e-132
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000268
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.06e-73
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73668436|ref|YP_304451.1|
Sequence length 434
Comment methyl-coenzyme M reductase, beta subunit [Methanosarcina barkeri str. Fusaro]
Sequence
MSDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMG
GKGRQILGRGLNYDIVGNADAIAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIA
GADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSYPQTMDLMGGQVQGILSIPQ
NNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAY
QGLNANNLLYDIVKENGKDGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKW
NACAAVGTLAATLVNCGAGRAAQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGTQMFSIESTSGLIGDVFGAI
PEFREPIKAVAGVL
Download sequence
Identical sequences A0A0E3QIX1 P07955
gi|73668436|ref|YP_304451.1| WP_011305920.1.36239 WP_011305920.1.74748 269797.Mbar_A0897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]