SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73668560|ref|YP_304575.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668560|ref|YP_304575.1|
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.17e-18
Family TRAM domain 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73668560|ref|YP_304575.1|
Sequence length 68
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MFREESRSVPVEEGEVYDVTIQDIARQGDGIARIEGFVIFVPGTKVGDEVRIKVERVLPK
FAFASVVE
Download sequence
Identical sequences A0A0E3LV69 A0A0E3PZM0 A0A0E3Q9S5 A0A0E3QIJ4 A0A0E3QQJ9 A0A0E3RFY4 A0A0E3RQQ2 A0A0E3SJQ4 A0A0E3WY64 A0A0F8SXB9 A0A1E7GGH2 A0A2A2HZD3 Q46DP7 Q8PX65
gi|73668560|ref|YP_304575.1| 1yez_A 1yezA gi|21227459|ref|NP_633381.1| WP_011033303.1.11460 WP_011033303.1.12270 WP_011033303.1.13133 WP_011033303.1.13782 WP_011033303.1.14209 WP_011033303.1.14583 WP_011033303.1.14776 WP_011033303.1.15587 WP_011033303.1.16483 WP_011033303.1.16878 WP_011033303.1.18729 WP_011033303.1.18783 WP_011033303.1.21267 WP_011033303.1.21501 WP_011033303.1.2157 WP_011033303.1.21629 WP_011033303.1.21918 WP_011033303.1.23878 WP_011033303.1.24179 WP_011033303.1.29103 WP_011033303.1.29761 WP_011033303.1.32345 WP_011033303.1.33522 WP_011033303.1.35945 WP_011033303.1.36239 WP_011033303.1.40449 WP_011033303.1.41322 WP_011033303.1.42324 WP_011033303.1.43275 WP_011033303.1.43564 WP_011033303.1.43834 WP_011033303.1.44090 WP_011033303.1.44353 WP_011033303.1.4739 WP_011033303.1.49674 WP_011033303.1.4970 WP_011033303.1.53089 WP_011033303.1.53770 WP_011033303.1.57580 WP_011033303.1.58691 WP_011033303.1.61041 WP_011033303.1.61670 WP_011033303.1.62876 WP_011033303.1.63409 WP_011033303.1.63967 WP_011033303.1.64521 WP_011033303.1.64722 WP_011033303.1.65224 WP_011033303.1.66913 WP_011033303.1.7135 WP_011033303.1.7314 WP_011033303.1.73216 WP_011033303.1.73711 WP_011033303.1.74065 WP_011033303.1.74748 WP_011033303.1.75484 WP_011033303.1.75785 WP_011033303.1.76299 WP_011033303.1.7642 WP_011033303.1.76508 WP_011033303.1.8229 WP_011033303.1.82623 WP_011033303.1.82674 WP_011033303.1.83034 WP_011033303.1.8430 WP_011033303.1.84394 WP_011033303.1.88487 WP_011033303.1.90340 WP_011033303.1.9066 WP_011033303.1.90871 WP_011033303.1.91617 WP_011033303.1.94933 WP_011033303.1.95514 WP_011033303.1.98848 MaR30 000000368|e1yezA1|2.1.1.62|A:1-68 cath|current|1yezA00/1-68 d1yeza1 192952.MM_1357 269797.Mbar_A1027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]