SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73668628|ref|YP_304643.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73668628|ref|YP_304643.1|
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 1.83e-121
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73668628|ref|YP_304643.1|
Sequence length 276
Comment methylenetetrahydromethanopterin dehydrogenase [Methanosarcina barkeri str. Fusaro]
Sequence
MVNIGFIKMGNLGMSQVINLVQDEIAAREGITVRVFGTGAKMSPAEAAASESFKQWNADF
VIIISPNAAAPGPKAAREIWKDVPCIVVSDGPTKKEAREALENNGFGYLILPVDPLIGAK
REFLDPVEMASFNSDAMKVLSVCGVVRLVQEELDKVTDQVASGKSGKELELPHIFAKPEK
CVEYAGFANPYAKAKALAALHMAEKVAQVNFPACFMLKEIDQVCLTAAAGHEIMGAASQL
AIQAREIEKSNDTVLRQPHAKNGTLLKKVKLYQKPE
Download sequence
Identical sequences A0A0E3QR80 Q46DH9
WP_011306111.1.36239 WP_011306111.1.74748 269797.Mbar_A1095 gi|73668628|ref|YP_304643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]