SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73669541|ref|YP_305556.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73669541|ref|YP_305556.1|
Domain Number 1 Region: 5-245
Classification Level Classification E-value
Superfamily Aquaporin-like 8.37e-61
Family Aquaporin-like 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73669541|ref|YP_305556.1|
Sequence length 249
Comment glycerol uptake facilitator, MIP channel [Methanosarcina barkeri str. Fusaro]
Sequence
MTVPNLMKRALAELVGTYVLVFLGTGSVITTVLLMEGWEAFPGNQFYIGIDIAAWFAIGM
SFAIAITSMIYAFGHISGTHINPAVSLALWATGRFPTKDLPAYIISQLIGASLASFTLVA
ILGMRAVDAGLGATSMFYGVGYGQAIFCEAVCTFFLMLTIMGTAVDRRAPPGFAGLAIGL
VVAADVIVVGNITGSSLNPARTFGPYLAESLLGGANLWAQFPIYIIGPIAGALVAAFLYD
FIAEPKKAD
Download sequence
Identical sequences A0A0E3QPQ4 Q46AW6
269797.Mbar_A2042 WP_011307022.1.36239 WP_011307022.1.74748 gi|73669541|ref|YP_305556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]