SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73669549|ref|YP_305564.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|73669549|ref|YP_305564.1|
Domain Number - Region: 18-87
Classification Level Classification E-value
Superfamily Aquaporin-like 0.00523
Family Aquaporin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73669549|ref|YP_305564.1|
Sequence length 119
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MYFLGSDKRFLSGLFDKFLLYFEWIFEAIGTTIIIYGGLRAIIQIFSTEALKKSQNLEKI
RKELTNRILFGLEFYIVVAILGTLRNPDIQDLTVLGTIVLIRTILGYFLGKEVKEYHFD
Download sequence
Identical sequences A0A0E3QNI0 Q46AV8
gi|73669549|ref|YP_305564.1| WP_011307030.1.36239 WP_011307030.1.74748 2005301981 269797.Mbar_A2050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]