SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73669992|ref|YP_306007.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73669992|ref|YP_306007.1|
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily RING/U-box 2e-27
Family Zf-UBP 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73669992|ref|YP_306007.1|
Sequence length 86
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MVCTHRNMIKIKNIEQGSKGCEECLKSGDSWVHLRICLTCGHVGCCDQSKNKHATKHFEE
TGHPVIQSFEPGEDWKYCYIDRQYLE
Download sequence
Identical sequences A0A0E3QKN4 Q469L5
gi|73669992|ref|YP_306007.1| WP_011307470.1.36239 WP_011307470.1.74748 269797.Mbar_A2514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]