SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73669996|ref|YP_306011.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73669996|ref|YP_306011.1|
Domain Number 1 Region: 450-555
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000192
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|73669996|ref|YP_306011.1|
Sequence length 566
Comment sulfate transporter [Methanosarcina barkeri str. Fusaro]
Sequence
MKPAQNSRRSFHYSLFQGILPLKSKQIPLEIAAGITFAAFAIPEVMGYTKIAGMPVVTGI
YTILFPMLAFAIFGSSRHLVVGADSATAAIIASGLTTIAVPGSSQYVAYASAIALLVAIL
LFLGGLLQLGFLADFLSYTILIGFLTGVGIYISISQISGMLGIPSEPDGTSVQILSLVRN
LSLTNTSTLLVSLSVIGVIVLGEKLSHKFPGSLIAIIGAIAASRILDLSSYGISILGAVP
QGLPQISLPQIPLSNLPEIFNISISCFIIILAQSAATSRAYAIKFSDTFNENTDLIGLSL
ANAAAGISGTFVVNGSPTKTEMIKNAGGRTQLTQLTTVFTVILVLLFFTRPFAYLPTAVL
SSMVFLIGLHLIDIKGMTSLHRQRPVEFAVALITAITVVVIGVEQGILIAIVLSIIAHLR
HSYRPLNLLLVPKAGGAMKTFPLESGQQAVEGLLIYRFGSNLYFANEGRFAEEIIDLAIK
NGSLKWFCISATNIGDIDFTSAETLKKVYTELQKLDITLVLSEVVQPVMNELDRDGITQM
IGKDHIFESVQDVIEEYKRSTDSSLR
Download sequence
Identical sequences A0A0E3QNN9 Q469L1
269797.Mbar_A2518 gi|73669996|ref|YP_306011.1| WP_011307474.1.36239 WP_011307474.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]