SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73670175|ref|YP_306190.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73670175|ref|YP_306190.1|
Domain Number 1 Region: 53-195,290-397
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.49e-26
Family Terpene synthases 0.068
Further Details:      
 
Domain Number 2 Region: 465-612
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.49e-21
Family Protein prenyltransferases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|73670175|ref|YP_306190.1|
Sequence length 626
Comment hypothetical protein Mbar_A2706 [Methanosarcina barkeri str. Fusaro]
Sequence
MSRKIYAPVIILMILIITSGCIEGKHLSIEGKNSSIGGEYSPSQEPKQITNLNESWVTDT
RNRMDDSQGIDGGYSDFPPQEPILYSTFYFLESLKLLDKEPKYEQATIDWLLSQEQEITR
QDNNSNMDNIYFLTISLDILKVKPANRSNLISKVMELQMPDGSFAQKKGDKGTLLDTFRA
ITTLHTLDVDLNQVPLTKNWLIEKWMEPDENENLMYSTSEASLLISALKLYQVNVSSLQN
QSPRMEIIKEQENIIENQLKLLPDTQMDLLTLSSFTDFLLINGSVSSEIRSDIETYLQKR
QLEDGGFNALLDKYGEPQGTYLALKIASNLGFDLNDNVSTFIYNYEPLNGIGGFRPAYRL
ISSSENTYLAVKSLKVLGSEPSDKEKLLKYVDNNWQEESKKAKTAYYLLVICNLLNQPYP
TDTQFREEVKTSFDKFANQPIDSNDLEEVLYLAKVANLLGIELNNKDKLIAKLQSSQQED
GGFGFEASDLFMTFYVVNTLEELGSCPVDKKGCISWIQEGQITDGGFIIRRGPVHTNSSD
IYSTYMSVVSLNALDAKPENFDKLFEWLKDCQDEHGGFKLAPKYANLDTSESSFEAKLEY
TSWGLMAWSTLSDEQTSKNLLNNSGT
Download sequence
Identical sequences A0A0E3QMP0 Q468T2
gi|73670175|ref|YP_306190.1| NYSGXRC-20051a 269797.Mbar_A2706 WP_011307651.1.36239 WP_011307651.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]