SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|73670435|ref|YP_306450.1| from Methanosarcina barkeri str. Fusaro

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|73670435|ref|YP_306450.1|
Domain Number 1 Region: 391-610
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 9.42e-50
Family DNA/RNA non-specific endonuclease 0.001
Further Details:      
 
Domain Number 2 Region: 83-301
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-27
Family Prokaryotic proteases 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|73670435|ref|YP_306450.1|
Sequence length 631
Comment conserved hypothetical protein [Methanosarcina barkeri str. Fusaro]
Sequence
MLKNAREEQQRKASERYYIRQKAAEVEQPGERFRREIISPLTEAQPIERRLIFLEPGDNL
ALERIMGKSDLVNISYLELGLLAARPVCRIQVVNLFGRPEGYGTGFLVGPNLLLTNNHVL
DTAELARKSFAEFEFEQGINGRKKTSKSFDLRPDELFVTDPDMDFTFVSVAPIATEGTEL
TDYGLLRLVEDTGKVRTGEYVSIIQHPDGGLKNFCLRENEVVDIFDNWLYYLTDTQCGAS
GSPVFNDQWLVVGLHHSGVPMKDAQGNILKTDGQPYQEGIDDPSTIAWVANEGVRISRIF
KALESRSENEPMAAEALRRLRSHGTGPVGPAIITAPEPIPNAVMELELGKLPMEHYSLAD
GYNPDFLGSLYHLPLPKLADNLQSKVATLKDGGKILTYLHFSIVMNADRRLAFYTAANID
GKKLEKIKRIRDKWYFDPRLDQKYQAGPKLYADNPLDRGHLVRRLDPCWGPNARDAGEDT
FHFTNCSPQHKRLNQHDWLEVEDYILKTADNANAQISVFTGPVFREDDMIYRNEYLLPAD
FWKVVVFVNKNGKFGATAYLRTQKNYLESREFFDDEFKTWQVPVVQVEALTGISFGLPKD
ADPMARAAAGKGLESQRSYLRRIHSAADIML
Download sequence
Identical sequences A0A0E3QLB0 Q467S2
gi|73670435|ref|YP_306450.1| WP_011307910.1.36239 WP_011307910.1.74748 269797.Mbar_A2975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]