SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Paxru1|478498|CE296478_25264 from Paxillus rubicundulus Ve08.2h10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Paxru1|478498|CE296478_25264
Domain Number 1 Region: 312-391
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000158
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 2 Region: 408-514
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000199
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Paxru1|478498|CE296478_25264
Sequence length 589
Sequence
MSNAPQSRAQSRTQSRHSEAGGGSDDDVPLAQRVPTALTAQKSIRKQLRDERQQRRLERA
KGAHSIAPVPPLPTESIPVVVQHASLAHRQRSMSVTPVPASGSLRREQSRARPSPIDAFP
VEDLTRKLMTPHASSHTPPLTAPPSYDASAPAFFSARAAGYSNGVSRSSSRARHMDPAAY
KQQNPSRAPEASSQDRPLKPMRSFHRTEGRHAESRRVPVEATSAQRLGRGITAAGLSRSA
RNGGDNASTGYEQLPKPGRVSEDGRRPRPSIDRESEVAVQRVVQRPPMPPLPTPEVRSGL
PQQPMPRAAVVQQRIFVGDMQRFNMVEITPATNAGDVIDLVASQGMLDRSGSWMLFELAQ
DYGMERPIRDYELLADVSASWNKDKLLNAFVIKPTPLARILSRPAVPTSSPTHRGWVEWE
SKRGKWSKRWVELREHGLWLSKRDTGKDEIFLCSLSNFDAYYVTRRHKSPKPFVFAIKST
DHLSLFENAADYLHVFSCNPKDGEKWMEVILVARSYVLYQERHVLFTKSGELLSRAKPLT
RSQTRNQSVSSRPAQPLINVPPPFSQSPTANVTFEPGSLLAKQNGVTQP
Download sequence
Identical sequences A0A0D0E7I9
jgi|Paxru1|478498|CE296478_25264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]