SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FVEG_06137T0 from Fusarium verticillioides 7600

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FVEG_06137T0
Domain Number 1 Region: 296-402
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-31
Family PDI-like 0.033
Further Details:      
 
Domain Number 2 Region: 37-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.61e-20
Family PDI-like 0.073
Further Details:      
 
Domain Number 3 Region: 410-522
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000122
Family PDI-like 0.057
Further Details:      
 
Weak hits

Sequence:  FVEG_06137T0
Domain Number - Region: 627-679
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0706
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) FVEG_06137T0
Sequence length 757
Comment | FVEG_06137 | Fusarium verticillioides hypothetical protein similar to disulfide isomerase (758 aa)
Sequence
MRFSPLAILAGLSAVALAEEERNPVTDPTTFNGKSVPPFKELTPSNWEEETKKNKFWMVK
HYSPYCKHCTRFAPTFQTLYEFYYTSKPPTENPDDTFTKYYDFAFGTVNCVAYYDFCMDH
NIQSYPTTILYEDGKVFDTLRGIKNMTALTTSVENALSKTHPGRPALVELPQPGDTVYPA
PKAEEPAAEKKVEGTQGDAKAPVEKPAVNAEKPLDAAAEKPVEEPAGKNAGKSLDDITES
PKDAEKSDKTESTEKKPEESAAAKDENKNTFGADWKVPSTGQMLKKTKPKDTTPKYNLEG
TSVPLTPENFDKLVTSSKDPWFIKFYAPWCSHCKAMAPTWQQLAKNMQGKLNIGEVNCEA
DHKLCTQMGVKAFPTIYFVTGTEKAEYKGLRGVGDFVAYAEGALEVAGGVVDVDAESFKE
LEKTEEVLFVYFYDHATTTEDFKALDALPLNLIGRGKIVKTSDQELCSRFKITTWPRLLV
SREGRATYYTPITPDEMRDVDSLTSWMKSTWLPLVPEMTAINAKQIMSHKLVVLAILNRN
DEDRLQNSISELKNAANEWVDRQVQEFQLERKKLRDAKQMRIEEAQSRDDQRALRNAKAI
KIDMDSTHRKEVGFAWVDGIFWQRWIATTYNIDVRDGERIIINEEDRHQFWDTTPTGNQI
MVSHTSIMDTLDKIVYGPNPISPKYTIGTLAKFFFDIKMNFVDHPFLSIGLIIAVGFGLY
SWIRNRTRRSRGTFFRMDDSLGLKDGLLGQNGNDKSD
Download sequence
Identical sequences W7M2R0
FVEG_06137T0 XP_018751487.1.41959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]