SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397670638|ref|YP_006512173.1| from Propionibacterium propionicum F0230a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397670638|ref|YP_006512173.1|
Domain Number 1 Region: 79-484
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.36e-123
Family Di-heme elbow motif 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397670638|ref|YP_006512173.1|
Sequence length 505
Comment nitrite reductase (cytochrome, ammonia-forming) [Propionibacterium propionicum F0230a]
Sequence
MSPTTDNNDKPTTTEAVERTPDEVEKKKPTTWTGPRKRWVPIVVLLFVAVVAAGLTWLLT
NIFQHKEEARNPFTKVVELDDSTYDPAVWGKNFPIQYEQYKKTAEDTDGDFVKVDPTADD
PREYHTLSRIEMEPRAQLMWRGYAFSVDYTEPRGHEWALEDQKHTQRTQPKFKQPGTCLN
CHASMPEVYDKLGNGDRMAGFHAMNSMSYEEAVQHASSTIACIDCHDPKTMELRITRPAF
MEGIKKAKALEGITDYDVNRDATNQEMRTYVCAQCHVEYYFAGEGKTLTFPWDKGLTAYD
AMAYYDEVGWTDYKHAESGAPILKAQHPDFETWSQGIHAANGVTCADCHMAYQRNGAAKV
SNHQIMSPMANDETINASCLTCHHSTEAEMRQRVEKIQTTWQSSLNVSFTALEGLINDIK
AAEANGTATEEQLTLARDYQRKAQFVVDYSFSENGRGFHAPQYSVSMLNQATDWARSGQL
ALRGVSVENGVPPAIPEKHMPNKKN
Download sequence
Identical sequences I6X4M6
gi|397670638|ref|YP_006512173.1| WP_014846958.1.90705 WP_014846958.1.99876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]