SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397670639|ref|YP_006512174.1| from Propionibacterium propionicum F0230a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397670639|ref|YP_006512174.1|
Domain Number 1 Region: 12-143
Classification Level Classification E-value
Superfamily Multiheme cytochromes 3.38e-20
Family Di-heme elbow motif 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397670639|ref|YP_006512174.1|
Sequence length 144
Comment cytochrome c nitrate reductase, small subunit [Propionibacterium propionicum F0230a]
Sequence
MALAALLGAVLGVGVFTVFYSGSTEYLGDDPASCANCHAMNEQYEGWLKGSHHDVATCNS
CHAPHNDIVYKYINKADNGFWHALKFTFQNYPENIKIRDHNREIVEAACIDCHGDYVDQA
KNSSEHKGERMSCLRCHDGVGHKR
Download sequence
Identical sequences I6Y007
gi|397670639|ref|YP_006512174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]